PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00016.1.g05330.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB_related
Protein Properties Length: 1334aa    MW: 145573 Da    PI: 7.1428
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00016.1.g05330.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.21.9e-08634676347
                                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                     +W++eE e++ +  + +G++ +++I++ +  ++t  +c+++++k+
  Zjn_sc00016.1.g05330.1.sm.mkhc 634 PWSKEEKEIFMEMLANFGKD-FSKISSFLT-HKTTADCVEFYFKH 676
                                     8*****************99.********9.***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.48E-14618679IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-7625678IPR009057Homeodomain-like
PROSITE profilePS5129314.157630681IPR017884SANT domain
SMARTSM007173.4E-8631679IPR001005SANT/Myb domain
PfamPF002491.1E-6633676IPR001005SANT/Myb domain
PROSITE profilePS5129313.233838889IPR017884SANT domain
SMARTSM007178.3E-6839887IPR001005SANT/Myb domain
SuperFamilySSF466893.2E-9841889IPR009057Homeodomain-like
CDDcd001672.08E-4843881No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1334 aa     Download sequence    Send to blast
MPPGYTPSRS DRYWVDDEGG GYKGFSRYGG GGGRRDGRDM RGSFRRAPFR SYGNDLSRNH  60
QEQPPPPPGP PLWRSPLRSF AVPCYDDTGD RENQPQVAPW RRRENRSEAA GDMRGTFRRS  120
PFRSYDNDIS KNHQEHPPSS PPRRSPLSSF AVPIYDPPGT LVDKGDRDNL LRVTPWRRRE  180
NRSEAAGAAG VGHVSAGQST HPAASEKVVS THPLAVTSPH GAEEEAPRKK ARLGWGQGLA  240
KYEKQKVQGP SEPAEAVSDG SLAGTGQGVA FPAPAPALCA SPVAVPPPPP LCTSVVDAPP  300
PPPVLCASLV AVPSPHSAQC SSPVALPSPA PVLLGFASSV TVPAPAAAHP PCTSPVAVPS  360
PAPAAAPEDK SCELTANTFL DSTQDAPGGD NQACNIEFPI KEPRELSPCP KIPVVQDASA  420
KDAEMMEIET AHNAKTASSE ESAACPEEQA HAAADVGPMK ISGGAKLQID VDNEKLEGHF  480
SIPRNSDAVI KERLVLHKSR LRFKQNALTF KFRTLRYLWK QDARLLWARK QRSKSNKRID  540
HSGRTLHFGS QRQRSINRSR LLMPGNSSIF PTPEISDIAN KMYSEFQIKC CRNYLKMPVL  600
IINEKEKECS RFVNKNGLVE DPIAVEKERV LINPWSKEEK EIFMEMLANF GKDFSKISSF  660
LTHKTTADCV EFYFKHHKSD GFREVKKLLD QHQQQKPTSN FLGAKSGKKW DREANAASLD  720
ILGVASAVAA QGLEYEKRVD KISAKSLIRN GSNVSFVARK SSRECLDIVS LHERESVAAD  780
VLAGICDNLS PEGMSSCITS SADPSQVINI TRMEHALTQE IDKTADDKDR LSDEECEVDP  840
ADWNDDEKSI FIEAMNNYGK DFAQISSCVK SKSYEQCKVF FSKARKSLGL DLIHQAGADV  900
SMPTSDTNGG SRDNEACAAE MDSAICSSQY FAKTEMDVCT TERAMQGPTY CIISKQTEGD  960
GSNDCDGLDV KTEEGENKAD KICTLGQKLF SDVGHRSTCG PIDINCPETT EKLEGLDDTV  1020
DQMHMQNNSA IISSREQLEA SIEGCSHPAL DTALVKAGNS GPPASIAAET DIKENVRQLS  1080
KMTGASSIST VSASSYQHSI PGDKLPAKPK QHVTPLTPKD LMPVQFSSVL PDPTSIRFQG  1140
IASITTPNFK DTGNKACNAL EAKDMNKYPS FKDQSQSGQH TSLFRNISGY TKHVATDSPI  1200
FSERNTSGTE STSQSDQFTV TKFQNGRSSS LGVPKTTDGI HWDRGHSEVS NGSLRPYSCN  1260
TCSEGNEQIK RPGDVKLFGQ ILSHQSSSQN SGSSYYQQPV MQAHQSDQKR MERFSDPHKR  1320
NGMEFISGFQ RPGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C9e-156016831294NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D9e-156016831294NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440514.10.0hypothetical protein SORBIDRAFT_09g002290
TrEMBLC5YZ470.0C5YZ47_SORBI; Putative uncharacterized protein Sb09g002290
STRINGSb09g002290.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.14e-77MYB family protein